PNMA6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2096995
Artikelname: PNMA6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2096995
Hersteller Artikelnummer: orb2096995
Alternativnummer: BYT-ORB2096995-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA6A
Konjugation: Biotin
Alternative Synonym: MA6, PNMA6, PNMA6C
PNMA6A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 116271
UniProt: P0C5W0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FTVLGKVFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCS