PNMA6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096995
Article Name: PNMA6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096995
Supplier Catalog Number: orb2096995
Alternative Catalog Number: BYT-ORB2096995-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA6A
Conjugation: Biotin
Alternative Names: MA6, PNMA6, PNMA6C
PNMA6A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 116271
UniProt: P0C5W0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FTVLGKVFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCS