ATAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097052
Artikelname: ATAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097052
Hersteller Artikelnummer: orb2097052
Alternativnummer: BYT-ORB2097052-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATAD1
Konjugation: Biotin
Alternative Synonym: Msp1, AFDC1, HKPX4, FNP001, hATAD1, THORASE
ATAD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 116199
UniProt: Q8NBU5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVR