ATAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2097052
Article Name: ATAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2097052
Supplier Catalog Number: orb2097052
Alternative Catalog Number: BYT-ORB2097052-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATAD1
Conjugation: Biotin
Alternative Names: Msp1, AFDC1, HKPX4, FNP001, hATAD1, THORASE
ATAD1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 116199
UniProt: Q8NBU5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVR