HSDL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2097100
Artikelname: HSDL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2097100
Hersteller Artikelnummer: orb2097100
Alternativnummer: BYT-ORB2097100-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSDL1
Konjugation: Biotin
Alternative Synonym: SDR12C3
HSDL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 113651
UniProt: Q3SXM5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGI