HSDL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2097100
Article Name: HSDL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2097100
Supplier Catalog Number: orb2097100
Alternative Catalog Number: BYT-ORB2097100-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSDL1
Conjugation: Biotin
Alternative Names: SDR12C3
HSDL1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 113651
UniProt: Q3SXM5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGI