Sstr1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2098561
Artikelname: Sstr1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2098561
Hersteller Artikelnummer: orb2098561
Alternativnummer: BYT-ORB2098561-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sstr1
Konjugation: Biotin
Alternative Synonym: ss, Sms, SS1R, Smst, sst1, SS1-R, SRIF-2, SS-1-R, Smstr1, Smstr-1
Sstr1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 033242
UniProt: P30873
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC