Sstr1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2098561
Article Name: Sstr1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2098561
Supplier Catalog Number: orb2098561
Alternative Catalog Number: BYT-ORB2098561-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sstr1
Conjugation: Biotin
Alternative Names: ss, Sms, SS1R, Smst, sst1, SS1-R, SRIF-2, SS-1-R, Smstr1, Smstr-1
Sstr1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 033242
UniProt: P30873
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC