SLPI Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099042
Artikelname: SLPI Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099042
Hersteller Artikelnummer: orb2099042
Alternativnummer: BYT-ORB2099042-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLPI
Konjugation: HRP
Alternative Synonym: ALP, MPI, ALK1, BLPI, HUSI, WAP4, WFDC4, HUSI-I
SLPI Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 003055
UniProt: P03973
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK