SLPI Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099042
Article Name: SLPI Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099042
Supplier Catalog Number: orb2099042
Alternative Catalog Number: BYT-ORB2099042-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLPI
Conjugation: HRP
Alternative Names: ALP, MPI, ALK1, BLPI, HUSI, WAP4, WFDC4, HUSI-I
SLPI Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 003055
UniProt: P03973
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK