LCN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2099052
Artikelname: LCN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2099052
Hersteller Artikelnummer: orb2099052
Alternativnummer: BYT-ORB2099052-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LCN1
Konjugation: FITC
Alternative Synonym: TP, TLC, PMFA, VEGP
LCN1 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 002288
UniProt: P31025
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD