LCN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099052
Article Name: LCN1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099052
Supplier Catalog Number: orb2099052
Alternative Catalog Number: BYT-ORB2099052-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LCN1
Conjugation: FITC
Alternative Names: TP, TLC, PMFA, VEGP
LCN1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 002288
UniProt: P31025
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD