TGFB3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099126
Artikelname: TGFB3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099126
Hersteller Artikelnummer: orb2099126
Alternativnummer: BYT-ORB2099126-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGFB3
Konjugation: HRP
Alternative Synonym: ARVD, LDS5, RNHF, ARVD1, TGF-beta3
TGFB3 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 003230
UniProt: P10600
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW