TGFB3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099126
Article Name: TGFB3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099126
Supplier Catalog Number: orb2099126
Alternative Catalog Number: BYT-ORB2099126-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGFB3
Conjugation: HRP
Alternative Names: ARVD, LDS5, RNHF, ARVD1, TGF-beta3
TGFB3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 003230
UniProt: P10600
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW