NFATC1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099147
Artikelname: NFATC1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099147
Hersteller Artikelnummer: orb2099147
Alternativnummer: BYT-ORB2099147-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1
Konjugation: HRP
Alternative Synonym: NFAT2, NFATc, NF-ATC, NF-ATc1.2
NFATC1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 100kDa
NCBI: 765975
UniProt: B5B2M5
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSP