NFATC1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099147
Article Name: NFATC1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099147
Supplier Catalog Number: orb2099147
Alternative Catalog Number: BYT-ORB2099147-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1
Conjugation: HRP
Alternative Names: NFAT2, NFATc, NF-ATC, NF-ATc1.2
NFATC1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 100kDa
NCBI: 765975
UniProt: B5B2M5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSP