RNF128 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099162
Artikelname: RNF128 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099162
Hersteller Artikelnummer: orb2099162
Alternativnummer: BYT-ORB2099162-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF128
Konjugation: HRP
Alternative Synonym: GRAIL
RNF128 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 078815
UniProt: Q8TEB7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS