RNF128 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099162
Article Name: RNF128 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099162
Supplier Catalog Number: orb2099162
Alternative Catalog Number: BYT-ORB2099162-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF128
Conjugation: HRP
Alternative Names: GRAIL
RNF128 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 078815
UniProt: Q8TEB7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS