FAS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099171
Artikelname: FAS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099171
Hersteller Artikelnummer: orb2099171
Alternativnummer: BYT-ORB2099171-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAS
Konjugation: HRP
Alternative Synonym: APT1, CD95, FAS1, APO-1, FASTM, ALPS1A, TNFRSF6
FAS Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 000034
UniProt: P25445
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: GLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSK