FAS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099171
Article Name: FAS Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099171
Supplier Catalog Number: orb2099171
Alternative Catalog Number: BYT-ORB2099171-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAS
Conjugation: HRP
Alternative Names: APT1, CD95, FAS1, APO-1, FASTM, ALPS1A, TNFRSF6
FAS Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 000034
UniProt: P25445
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSK