SELE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099183
Artikelname: SELE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099183
Hersteller Artikelnummer: orb2099183
Alternativnummer: BYT-ORB2099183-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SELE
Konjugation: HRP
Alternative Synonym: ELAM, ESEL, CD62E, ELAM1, LECAM2
SELE Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 000441
UniProt: P16581
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: WVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERC