SELE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099183
Article Name: SELE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099183
Supplier Catalog Number: orb2099183
Alternative Catalog Number: BYT-ORB2099183-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SELE
Conjugation: HRP
Alternative Names: ELAM, ESEL, CD62E, ELAM1, LECAM2
SELE Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 000441
UniProt: P16581
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: WVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERC