CD3E Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2099201
Artikelname: CD3E Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2099201
Hersteller Artikelnummer: orb2099201
Alternativnummer: BYT-ORB2099201-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD3E
Konjugation: HRP
Alternative Synonym: T3E, TCRE, IMD18
CD3E Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 000724
UniProt: P07766
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP