CD3E Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099201
Article Name: CD3E Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099201
Supplier Catalog Number: orb2099201
Alternative Catalog Number: BYT-ORB2099201-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD3E
Conjugation: HRP
Alternative Names: T3E, TCRE, IMD18
CD3E Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 000724
UniProt: P07766
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP