TMLHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2102138
Artikelname: TMLHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2102138
Hersteller Artikelnummer: orb2102138
Alternativnummer: BYT-ORB2102138-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMLHE
Konjugation: HRP
Alternative Synonym: TMLD, TMLH, BBOX2, AUTSX6, TMLHED, XAP130
TMLHE Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 060666
UniProt: Q9NVH6
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV