TMLHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102138
Article Name: TMLHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102138
Supplier Catalog Number: orb2102138
Alternative Catalog Number: BYT-ORB2102138-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMLHE
Conjugation: HRP
Alternative Names: TMLD, TMLH, BBOX2, AUTSX6, TMLHED, XAP130
TMLHE Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 060666
UniProt: Q9NVH6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV