INTS13 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2102156
Artikelname: INTS13 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2102156
Hersteller Artikelnummer: orb2102156
Alternativnummer: BYT-ORB2102156-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C12orf11
Konjugation: HRP
Alternative Synonym: ASUN, GCT1, NET48, Mat89Bb, SPATA30, C12orf11
INTS13 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 060634
UniProt: Q9NVM9
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH