INTS13 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102156
Article Name: INTS13 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102156
Supplier Catalog Number: orb2102156
Alternative Catalog Number: BYT-ORB2102156-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C12orf11
Conjugation: HRP
Alternative Names: ASUN, GCT1, NET48, Mat89Bb, SPATA30, C12orf11
INTS13 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 060634
UniProt: Q9NVM9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH