RIC8B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2102162
Artikelname: RIC8B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2102162
Hersteller Artikelnummer: orb2102162
Alternativnummer: BYT-ORB2102162-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIC8B
Konjugation: HRP
Alternative Synonym: RIC8, hSyn
RIC8B Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 060627
UniProt: A2RTZ0
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL