RIC8B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102162
Article Name: RIC8B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102162
Supplier Catalog Number: orb2102162
Alternative Catalog Number: BYT-ORB2102162-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIC8B
Conjugation: HRP
Alternative Names: RIC8, hSyn
RIC8B Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 060627
UniProt: A2RTZ0
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL