ACHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2102774
Artikelname: ACHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2102774
Hersteller Artikelnummer: orb2102774
Alternativnummer: BYT-ORB2102774-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACHE
Konjugation: HRP
Alternative Synonym: YT, ACEE, ARACHE, N-ACHE
ACHE Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 000656
UniProt: P22303
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA