ACHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102774
Article Name: ACHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102774
Supplier Catalog Number: orb2102774
Alternative Catalog Number: BYT-ORB2102774-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACHE
Conjugation: HRP
Alternative Names: YT, ACEE, ARACHE, N-ACHE
ACHE Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 000656
UniProt: P22303
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA