PHYH Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2102949
Artikelname: PHYH Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2102949
Hersteller Artikelnummer: orb2102949
Alternativnummer: BYT-ORB2102949-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHYH
Konjugation: FITC
Alternative Synonym: RD, LN1, PAHX, LNAP1, PHYH1
PHYH Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 001032626
UniProt: O14832
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFR