PHYH Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2102949
Article Name: PHYH Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102949
Supplier Catalog Number: orb2102949
Alternative Catalog Number: BYT-ORB2102949-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHYH
Conjugation: FITC
Alternative Names: RD, LN1, PAHX, LNAP1, PHYH1
PHYH Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 001032626
UniProt: O14832
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFR