SET Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2103196
Artikelname: SET Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2103196
Hersteller Artikelnummer: orb2103196
Alternativnummer: BYT-ORB2103196-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SET
Konjugation: Biotin
Alternative Synonym: 2PP2A, IGAAD, MRD58, TAF-I, I2PP2A, IPP2A2, PHAPII, TAF-IBETA
SET Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 003002
UniProt: B2RCX0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT