SET Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103196
Article Name: SET Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103196
Supplier Catalog Number: orb2103196
Alternative Catalog Number: BYT-ORB2103196-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SET
Conjugation: Biotin
Alternative Names: 2PP2A, IGAAD, MRD58, TAF-I, I2PP2A, IPP2A2, PHAPII, TAF-IBETA
SET Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 003002
UniProt: B2RCX0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT