Rfc1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2103235
Artikelname: Rfc1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2103235
Hersteller Artikelnummer: orb2103235
Alternativnummer: BYT-ORB2103235-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rfc1
Konjugation: Biotin
Alternative Synonym: Recc1
Rfc1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 72kDa
UniProt: O88461
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG