Rfc1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103235
Article Name: Rfc1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103235
Supplier Catalog Number: orb2103235
Alternative Catalog Number: BYT-ORB2103235-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rfc1
Conjugation: Biotin
Alternative Names: Recc1
Rfc1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 72kDa
UniProt: O88461
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG