VPS54 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2103904
Artikelname: VPS54 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2103904
Hersteller Artikelnummer: orb2103904
Alternativnummer: BYT-ORB2103904-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS54
Konjugation: Biotin
Alternative Synonym: WR, HCC8, SLP-8p, VPS54L, hVps54L, PPP1R164
VPS54 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 057600
UniProt: Q9P1Q0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR