VPS54 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103904
Article Name: VPS54 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103904
Supplier Catalog Number: orb2103904
Alternative Catalog Number: BYT-ORB2103904-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS54
Conjugation: Biotin
Alternative Names: WR, HCC8, SLP-8p, VPS54L, hVps54L, PPP1R164
VPS54 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 107kDa
NCBI: 057600
UniProt: Q9P1Q0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR