Tex11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2103919
Artikelname: Tex11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2103919
Hersteller Artikelnummer: orb2103919
Alternativnummer: BYT-ORB2103919-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tex11
Konjugation: Biotin
Alternative Synonym: RGD1560239
Tex11 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 109kDa
NCBI: 001069708
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SCHTETNLSLYKNTVEKGIFHVLSYQAESAVAQGDFKKASICVLRCKDML