Tex11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103919
Article Name: Tex11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103919
Supplier Catalog Number: orb2103919
Alternative Catalog Number: BYT-ORB2103919-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tex11
Conjugation: Biotin
Alternative Names: RGD1560239
Tex11 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 109kDa
NCBI: 001069708
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SCHTETNLSLYKNTVEKGIFHVLSYQAESAVAQGDFKKASICVLRCKDML