C10orf96 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104339
Artikelname: C10orf96 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104339
Hersteller Artikelnummer: orb2104339
Alternativnummer: BYT-ORB2104339-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf96
Konjugation: Biotin
Alternative Synonym: C10orf96
C10orf96 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 940917
UniProt: P0C7W6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES