C10orf96 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104339
Article Name: C10orf96 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104339
Supplier Catalog Number: orb2104339
Alternative Catalog Number: BYT-ORB2104339-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf96
Conjugation: Biotin
Alternative Names: C10orf96
C10orf96 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 940917
UniProt: P0C7W6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES