IL1F5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2104744
Artikelname: IL1F5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2104744
Hersteller Artikelnummer: orb2104744
Alternativnummer: BYT-ORB2104744-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL1F5
Konjugation: Biotin
Alternative Synonym: FIL1, FIL1D, IL1F5, IL1L1, PSORP, IL1HY1, IL1RP3, IL36RA, IL-36Ra, PSORS14, FIL1(DELTA)
IL1F5 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 775262
UniProt: Q9UBH0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD