IL1F5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104744
Article Name: IL1F5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104744
Supplier Catalog Number: orb2104744
Alternative Catalog Number: BYT-ORB2104744-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL1F5
Conjugation: Biotin
Alternative Names: FIL1, FIL1D, IL1F5, IL1L1, PSORP, IL1HY1, IL1RP3, IL36RA, IL-36Ra, PSORS14, FIL1(DELTA)
IL1F5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 775262
UniProt: Q9UBH0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD