FAM124A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2105005
Artikelname: FAM124A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2105005
Hersteller Artikelnummer: orb2105005
Alternativnummer: BYT-ORB2105005-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM124A
Konjugation: Biotin
Alternative Synonym: FLJ30707
FAM124A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 659456
UniProt: Q86V42
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT