FAM124A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2105005
Article Name: FAM124A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2105005
Supplier Catalog Number: orb2105005
Alternative Catalog Number: BYT-ORB2105005-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM124A
Conjugation: Biotin
Alternative Names: FLJ30707
FAM124A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 659456
UniProt: Q86V42
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT