PHGDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2106079
Artikelname: PHGDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2106079
Hersteller Artikelnummer: orb2106079
Alternativnummer: BYT-ORB2106079-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHGDH
Konjugation: Biotin
Alternative Synonym: NLS, PDG, PGD, NLS1, PGAD, PGDH, SERA, 3PGDH, 3-PGDH, PHGDHD, HEL-S-113
PHGDH Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 006614
UniProt: O43175
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF