PHGDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2106079
Article Name: PHGDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2106079
Supplier Catalog Number: orb2106079
Alternative Catalog Number: BYT-ORB2106079-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHGDH
Conjugation: Biotin
Alternative Names: NLS, PDG, PGD, NLS1, PGAD, PGDH, SERA, 3PGDH, 3-PGDH, PHGDHD, HEL-S-113
PHGDH Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 006614
UniProt: O43175
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF